❤️🧡💛💚💙💜🖤

#customdesign

#love #instagood #photooftheday #fashion #beautiful #happy #cute #tbt #like4like #followme #picoftheday #follow #me #selfie #summer #art #instadaily #friends #repost #nature #girl #fun #style #smile #food #travel #holiday

Late Post 🏎

The precious thing is the craftsmanship in custom furniture design. . LIVING YOUR DREAM . CV. MEBEL INTERNASIONAL Furniture Manufacturer & Workshop Jl. Tambak Aji VI No.2, Industrial Area Semarang 50185 - 📨 chris@mebelinternational.com www.mebelinternational.com . .furniture finest worldwide Indonesia exportquality customdesign woodenfurniture interiordesigner beautiful details craftsmanship meubel design stylish homedecor homeliving homefurniture interiordesign homeandliving livingyourdream mebelinternational

Kavling Sangat Siap Bangun (Tanah Sudah Matang) NOUKA VILLAGE Cisarua, Lembang. . Berbeda dengan beli kavling biasa karena, Anda TIDAK PERLU lagi keluar biaya2 lain seperti layaknya membeli kavling di tanah mentah: . 1. Biaya pematangan lahan. 2. Biaya urugan. 3. Biaya galian. 4. Biaya pengerjaan jalan. 5. Biaya pembebasan buka akses Jalan utama. 6. Biaya pekerjaan saluran air. 7. Biaya perizinan (IMB). 8. Biaya Balik Nama dan SHM. 9. Biaya Pecah Sertifikat 10. Biaya pemasangan jaringan air. 11 Biaya pemasangan jaringan listrik. 12.Biaya SOSIAL tidak terduga (Pungli oknum preman,Ormas, dll). . Awalnya nampak murah jika Anda hitung per meter persegi, setelah Anda melakukan pembangunan fisik, barulah Anda akan terkejut dengan biaya2 yg timbul di lapangan. . Awas Jangan Terkecoh!! . Beli kavling sangat siap bangun di Nouka Village sekarang. . Untung saat membeli. Bukan bukan hanya saat menjual. . CASH ONLY. 6 units Kavling Sangat Siap Bangun (KSSB): . • B1. Luas Kavling 66 (Lebar 5,5 X 12,10). Harga Rp.255.300.000. • B2. Luas Kavling 73 (6X12,2). Harga Rp.281.900.000. • B3. Luas Kavling 74 (6X12,3). Harga Rp.285.700.000. • B5. Luas Kavling 75 (6X 12,5). Harga Rp.289.500.000. • B6. Luas Kavling 76 (6X 12,78). Harga Rp.293.300.000. • B7. Luas Kavling 77 (6X 12,92). Harga Rp.327.100.000 (HOOK). . Sudah termasuk fasilitas: • Row jalan utama 6 meter (cor + paving block). • Row jalan koridor 5.5 meter (paving block). • Fasilitas umum (taman kawasan dan jalan). • Benteng keliling komplek. • Pos Satpam. • Keamanan 24 Jam. • CCTV kawasan. • Masjid Al Mutazam. • Jaringan Air PDAM. • Jaringan Listrik. . BONUS: Pecah Sertifikat, Balik Nama + SHM & IMB. . More info click: http://wa.me/62818227172 ATAU download: https://saudagarmuda.page.link/ffGv . .NoukaVillage cisarua lembang jawabarat floatingmarket cimahi DusunBambu TangkubanPerahu WisataAlamKebunBegonia UPI UNPAS STPBandung padalarang gedungsate perumahansyariah kprsyariah customdesign villa homestay passiveincome investasisyariah kampunggajah rumahsyariahmurahberkah

Banyak yang bertanya bisa nggak sih keluar kota? Bisaa banget kak.., client kami memang banyak yang pesan dari diluar kota seperti Jakarta, Bandung, Malang, Bali dst. Mahal dong pengirimannya? Nggak kok kak, untuk pengiriman kami selalu pakai jasa cargo karena jauh lebih murah dibanding paket dan dokumen. Untuk pemesanan urgent bisa kami kirim melalui jasa travel, bus atau kereta jadi dipastikan satu hari bisa sampai ------------------------------------------------------------------------------------------------------------------------------------------------. for infomation and price list please contact Whatsapp : 085710335508  Line : trimediaadv16 Email : artvertising4@gmail. com . . .weddinginspiration weddinginvitationinvitationcard weddingcard weddingdreamundanganjawa  bridestory undanganjogja custominvitationcreativeinvitation undanganpernikahankreatifundanganpernikahan undanganmurah  floralinvitationundanganmurah undanganbandung customundangancustomdesign designinvitation invitationcardundanganrusticundanganjakartaweddinginspiration undanganunikundanganhardcover undangansinglehardcoverundanganpernikahan

Assalamualaikum @printing_baju_gempak @printing_baju_gempak @printing_baju_gempak Nak buat baju ? baju tshirt murah & berkualiti ? Pm laju2 utk harga yg special 🤩 Design baju yang sentiasa terbaik untuk anda 👕 Whatsapp kami : 0199628304 1)design 2)kuantiti 3)bajet Insha Allah nanti kami akan balas n quote harga sepantas mungkin. T&C sayajualbajusayasukabajuprintingbajucustomjombuatbajubajucetakbajucustomdesignsilkscreenprintingheatpresstshirtprintingmurahtshirtdesigntshirtprintinglokalahmenfashionwomanfashionfashionprintingmalaysiaprintinglifeprintingservicebajukelasmalaysia

Images from the @adidasOriginals OZWEEGO Hype DC | QV Melbourne store window install we created last year. Custom steel frame coated in the ozweego campaign colourway. Poster: @bradleypinkerton @hypedc @diversifiedmachining build marketing shoes adidasoriginals customfabrication pointofsale customdesign retail powdercoat brandactivation brandexperience kingswoodcreative visitmelbourne

Promosi jersi custom SUBLIMATION BASKETBALL dengan harga RM45.00 sehelai (jersi) & RM65.00 satu set (jersi & seluar). Minimum order 8pcs keatas. Hubungi kami :- . Hotline & WhatsApp : 016-2330237 Office : 03-74966421ThePrintingDudes TPD CustomJersey JersiCustom SublimationPrinting SublimationJersey SublimationJerseySet Sublimation CustomDesign Jersey Jersi Football Futsal BolaSepak Basketball BolaKeranjang

‼️ @drummagician ‼️thanks for his performance with Trexist Cymbals 💯⭐️✌🏽✌🏻 cymbals cymbalporn cymballove gospel groove drummer drums drummersofinstagram drumming music musician drummachine drummagazine cymbaladdict customdesign cymbalholic @_dogukan_okur_

LABEL NAMA ANAK : 100% ANTI AIR / WATERPROOF⁠ .⁠ Desain ciamik anti mainstream!!⁠ .⁠ Sering kehilangan kotak makan/tempat minum di pantry kantor? Botol minum si kecil sering tertukar dgn temannya? Si kakak sering kehilangan alat tulis?⁠ .⁠ Label Nama kami solusinya. Dengan DESAIN beragam, menarik dan tentunya ANTI MAINSTREAM, label nama kami menjawab permasalahan si kakak, si kecil maupun anda yang sering kehilangan ataupun tertukar peralatan tulis dan kotak bekalnya. Bahan yg kami gunakan pun WATERPROOF, sehingga aman jika terkena air, bahkan terendam di air.⁠ .⁠ Kode Desain SLNAx : 1.5x5.5 cm - 55 pcs : Rp.40.000⁠ .⁠ Kode Desain SLNBx : 1.5x4 cm - 102 pcs : Rp.50.000⁠ .⁠ Kode Desain SLNCx : 5x5 cm - 100 pcs : Rp.60.000⁠ .⁠ Kode Desain SLNDx : Ukuran Campur - 100 pcs : Rp.75.000⁠ .stikernamaantisobekstikernamaexostikernamahellokittystikernamakarakterstikernamaanaksekolahstikernamaspidermanstikernamamickeymousestikernamafrozenstikernamalitleponystikernamalucucustomnotebooknotebookcustomnotebookcustomdesigndesignnotebooknotebookmurahbukucustomcustombookdesigncustombukulucuinfinitylabelbekasi

CROWN CREATION // The Cardinia comes in 3 ways, each of which include an outdoor area, and an open-plan living/kitchen space. ✨ . This design grants the opportunity for an additional study area, or even a further bedroom if desired. ✔️ What more could one desire? . Make the Cardinia your own in 2020. We can't wait to hear from you on on 0437 568 933! 📞 . . .crownconstruction crowncustomhome crownluxuryhome housedesign wangaratta bright beechworth yarrawonga benalla victoriaaustralia wangarattabusiness visitwangaratta housedesign houseconstruction homedesign homeinspiration homeinspo customdesign customhomes customhome customhomebuilder designplan customdesigns

PUSAT PERCETAKAN BUKU YASIN DI KARAWANG 📌 Harga tergantung banyaknya pesanan dan model covernya 📌 Banyak isian pilihaan isian buku, model cover, dan assesories ➡️ Terdapat 4 lampiran didalamnya : 1. Doa innalillahi 2. Foto Almarhum/Almarhumah (Lahir & Wafat) 3. Do'a Almarhum/Almarhumah 4. Ucapan terima kasih berikut data keluarga yg ditinggalkan ➡️ Jenis Model Cover : 1. Buku yasin softcover custom 2. Buku yasin hardcover linen poly 3. Buku yasin hardcover rcp/embos 4. Buku yasin hardcover mengkilap 5. Buku yasin hardcover bludru 6. Buku yasin hardcover poly full 7. Buku yasin hardcover bludru busah ➡️ Pelengkap Assesories : 1. Sudut siku 2. Pembatas rumbay 3. Tile 4. Tasbih ➡️ Jenis Halaman Isian Buku : 1. Yasin 128 hvs 2. Yasin 192 hvs 3. Yasin 192 mp 4. Yasin 208 mp 5. Yazin 240 hvs 6. Yasin 224 mp 7. Ms 480 hvs 8. Ms 484 hvs 9. Ms 484 mp 10. Ms 496 mp 📍Lokasi Produksi KARAWANG KOTA More Info silahkan hub admin 087779600069 Bagi pemesanan online gratis ongkir untuk daerah jabodetabek. yasintahlil bukuyasin yasinkarawang pusatyasincustomdesignyasinmukaribarokah softcovermotif7hari 40hari 100hari haolcetakonline

PUSAT PERCETAKAN BUKU YASIN DI KARAWANG 📌 Harga tergantung banyaknya pesanan dan model covernya 📌 Banyak isian pilihaan isian buku, model cover, dan assesories ➡️ Terdapat 4 lampiran didalamnya : 1. Doa innalillahi 2. Foto Almarhum/Almarhumah (Lahir & Wafat) 3. Do'a Almarhum/Almarhumah 4. Ucapan terima kasih berikut data keluarga yg ditinggalkan ➡️ Jenis Model Cover : 1. Buku yasin softcover custom 2. Buku yasin hardcover linen poly 3. Buku yasin hardcover rcp/embos 4. Buku yasin hardcover mengkilap 5. Buku yasin hardcover bludru 6. Buku yasin hardcover poly full 7. Buku yasin hardcover bludru busah ➡️ Pelengkap Assesories : 1. Sudut siku 2. Pembatas rumbay 3. Tile 4. Tasbih ➡️ Jenis Halaman Isian Buku : 1. Yasin 128 hvs 2. Yasin 192 hvs 3. Yasin 192 mp 4. Yasin 208 mp 5. Yazin 240 hvs 6. Yasin 224 mp 7. Ms 480 hvs 8. Ms 484 hvs 9. Ms 484 mp 10. Ms 496 mp 📍Lokasi Produksi KARAWANG KOTA More Info silahkan hub admin 087779600069 Bagi pemesanan online gratis ongkir untuk daerah jabodetabek. yasintahlil bukuyasin yasinkarawang pusatyasincustomdesignyasinmukaribarokah softcovermotif7hari 40hari 100hari haolcetakonline

PORTFOLIO INDIsign . . Project : Taman Sakura Pratista Location : Bandung - Indonesia . . Arsitektur and Interior design : @indisignofficial Arsitektur and Interior build : @indisgnofficial . All photo uploaded are real image. . . We are here to realize your dreamed Call for any inquiries and further information : 0899.4010.086 / 0857.9421.8827 . . .designcustomdesigninteriorinteriordesigninteriordesignbandunginteriordesignindonesiadesaincustomfurnitureindisignindisignbandungindisignjawabaratindisignindonesiadesaindesaininteriordesaininteriorbandungdesaininteriorindonesiadesainerinteriordesainerindonesiadesainerindonesia👌desainerinteriorbandungdesainerinteriorindonesiapremiumpremiumqualityjualmebeljualmebeuljualbangunanbikinmebelbikinmebeuljasaarsitekturjasainterior

PUSAT PERCETAKAN BUKU YASIN DI KARAWANG 📌 Harga tergantung banyaknya pesanan dan model covernya 📌 Banyak isian pilihaan isian buku, model cover, dan assesories ➡️ Terdapat 4 lampiran didalamnya : 1. Doa innalillahi 2. Foto Almarhum/Almarhumah (Lahir & Wafat) 3. Do'a Almarhum/Almarhumah 4. Ucapan terima kasih berikut data keluarga yg ditinggalkan ➡️ Jenis Model Cover : 1. Buku yasin softcover custom 2. Buku yasin hardcover linen poly 3. Buku yasin hardcover rcp/embos 4. Buku yasin hardcover mengkilap 5. Buku yasin hardcover bludru 6. Buku yasin hardcover poly full 7. Buku yasin hardcover bludru busah ➡️ Pelengkap Assesories : 1. Sudut siku 2. Pembatas rumbay 3. Tile 4. Tasbih ➡️ Jenis Halaman Isian Buku : 1. Yasin 128 hvs 2. Yasin 192 hvs 3. Yasin 192 mp 4. Yasin 208 mp 5. Yazin 240 hvs 6. Yasin 224 mp 7. Ms 480 hvs 8. Ms 484 hvs 9. Ms 484 mp 10. Ms 496 mp 📍Lokasi Produksi KARAWANG KOTA More Info silahkan hub admin 087779600069 Bagi pemesanan online gratis ongkir untuk daerah jabodetabek. yasintahlil bukuyasin yasinkarawang pusatyasincustomdesignyasinmukaribarokah softcovermotif7hari 40hari 100hari haolcetakonline

PORTFOLIO INDIsign . . Project : Taman Sakura Pratista Location : Bandung - Indonesia . . Arsitektur and Interior design : @indisignofficial Arsitektur and Interior build : @indisgnofficial . All photo uploaded are real image. . . We are here to realize your dreamed Call for any inquiries and further information : 0899.4010.086 / 0857.9421.8827 . . .designcustomdesigninteriorinteriordesigninteriordesignbandunginteriordesignindonesiadesaincustomfurnitureindisignindisignbandungindisignjawabaratindisignindonesiadesaindesaininteriordesaininteriorbandungdesaininteriorindonesiadesainerinteriordesainerindonesiadesainerindonesia👌desainerinteriorbandungdesainerinteriorindonesiapremiumpremiumqualityjualmebeljualmebeuljualbangunanbikinmebelbikinmebeuljasaarsitekturjasainterior

Flags with constant movement through natural wind. Flags have proven to be one of the most cost effective types of eye-catching signage. @piraphics Call us today to order 949.228.3940 eyecatching signs featherflags trinidadsigns tourismtt piraphics events flags printing printedflags promo promotionalproducts eventsignage advertising flyingtheflag piraphics orangecounty la supportlocalbusiness design impact photo graphics logo branding customdesign

Open-plan living granny flats make the perfect solution for spaces away from the home. Create a welcoming space to entertain your family and guests. Learn more about us at https://buff.ly/2JNYv4Q.⠀ .⠀ .⠀ .⠀newconstruction newbuild customdesign customhomes custombuild homebuilders homebuilders home construction building interiordesign architecture amescorp

If you are looking at a Commercial Extension or a full Residential Refurbishment your project is going to involve coordinating multiple trades such as builders, electricians, carpenters, plumbers and painters. Linkbuild is a one stop shop solution - you will only have to deal with one company for any service requirement, while we deliver value for money and timely project completion. Discover the Linkbuild difference!lbuildsolutions perthnow perthbusiness perthsbest pertheveryday perthlocal perthisokay perthiscool perthbuilders perthbuilding perthlandscaping fremantle perthlocalbusiness renovationbuildersperth homerenovationsperth renovationsperth officefitout perthoffice custombuildperth builderswa buildersperth customdesign perthhomes officerenovation perthdemolition

PORTFOLIO INDIsign . . Project : Location : . . Arsitektur and Interior design : @indisignofficial Arsitektur and Interior build : @indisgnofficial . All photo uploaded are real image. . . We are here to realize your dreamed Call for any inquiries and further information : 0899.4010.086 / 0857.9421.8827 . . .designcustomdesigninteriorinteriordesigninteriordesignbandunginteriordesignindonesiadesaincustomfurnitureindisignindisignbandungindisignjawabaratindisignindonesiadesaindesaininteriordesaininteriorbandungdesaininteriorindonesiadesainerinteriordesainerindonesiadesainerindonesia👌desainerinteriorbandungdesainerinteriorindonesiapremiumpremiumqualityjualmebeljualmebeuljualbangunanbikinmebelbikinmebeuljasaarsitekturjasainterior

A new custom tutu plate under construction... can you guess the colour?

Let's say it🙌🙌🙌🙌🙌🙌🙌🙌🙌again & again & again & again & again & again & again & again & again & again🙌🙌🙌🙌❣ Stay H💗me❣❣❣❣ Stay H💗ME!!!! Imagination 🙌🙌🙌🙌🙌 Stepping BACK🙌🙌🙌🙌 Make believe 🙌🙌🙌🙌🙌 Imagination 🙌🙌🙌🙌 Intentional 🙌🙌🙌🙌 ✌✌ soar. . . .inspired becoming inprogress working businessowner modernismo.design goals goodvibesonly interiordesign designerlife realestate 2020 lux customdesign brand tinyhouse kitchendesign moderndesign newprojects health alliswell happy mentalhealthawareness beliveinyourself imagination harmony healingStay home enjoy the weather your family and thank God you're healthy>>> count your blessings 🙌🙌🙌

Latest custom rearview mirror hanger! Honestly when someone gives me a pendant to use to make an order I never know what it is going to become. The designing part is my favorite. I get all sorts of ideas and change things around and most of the time it ends up taking on a life of its own. I’m really happy with how this one turned out. ❤️ winniethepooh rearviewmirrorcharm poohbear customorder customdesign rearviewmirrorhanger custom ilovemakingjewelry unique oneofakind uniquegift handmade handmadegift handmadegiftsarethebest greenwatersjewelry ilovemyjob idocustomorders customjewelry ifeverthereistomorrow whenwereapart illalwaysbewithyou poohsgrandadventure

Something pretty I finished last year, I just loved this colour combo, it was adventurous and completely paid off. The colours all compliment each other and the yellow gold makes the navy and pink just pop!! Things are running in here, but a little different and slower. More phone chats and less faces.... but we can still design remotely if you are comfortable with that. My casting services and suppliers are all running a little differently, some as usual behind closed doors, one or two have closed and others one day a week... so I ask that you be patient with me at the moment. Everything is just running a bit slower, so I am also. But I am still making a little, and designing and researching for lots of sparkly things, ready for some future custom and wedding band meetings... when we can do so safely again. Feel free to still reach out with enquiries and in regards to customs. I’m still available to chat. Sending out so much love... and thanking everyone for your support of my little business. ❤️❤️. chloemccolljewellery jewellery jewelry custom customdesign sapphire engagement ring engagementring gold yellowgold

CALLING FOR GAMERS ! . Screenshot gambar dan whatsapp kami untuk submit order . PRE ORDER 14 HARI WAKTU BEKERJA ya🔥 . MINIMUM ORDER 10 PCS per 1 design . Available for ✅ POLO COLLAR ✅ ROUNDECK ✅ LONG SLEEVE ✅ MANDARIN COLLAR ✅ MUSLIMAH . Material ❄️Mini Eyelet ❄️Reversed Eyelet (Tahan lasak,sejuk,selesa,sesuai untuk semua aktiviti) . Design 👨🏻‍🎨 LOGO 👨🏻‍🎨 SPONSOR 👨🏻‍🎨 NAMESET 👨🏻‍🎨 WARNA . Jika berminat, boleh terus whatsapp admin +6016 873 4391 atau boleh klik sahaja link pada bio instagram HJ . Thanks for supporting US! 🔥 .bajusukan bajumurah jersifutsalmurah jersifutsalcustom bajukonvoi jersibolamurah jersibolacustom esport esportjersey teamjersey customdesign futsaljersey futsal imtiaz imtiazmalaysia imtiazqber bajubatch bajuhomeroom mrsm sbp esportjerseymurah volleyballjersey jerseybolatampar bajukelas bajubatch bajuhomeroom futsalista covid_19 stayumah siladudukrumah corona

Time to start some wedding snaps again. Grace and Damien's Quamby estate wedding was a real treat, they are such a gorgeous couple, literally and figuratively!!. A smaller wedding party let us utilise the dining room in the main homestead, which we absolutely love to do. Check out the full feature on our newly launched website. www.ashandbradbespoke.com ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Amazing photos by @fionavailphotography discovertasmania tasmanianweddingstylist tasmanianweddingplanner customdesign

Why design your own Velorbis? The “mega-trend” of individualization is a global phenomenon. This shift in values involves an increasing yearning for individuality. The desire to be unique and distinguish oneself from the masses has great significance rideinstyle custommade danishdesign velorbis ibikecph retrocycle vintagecycle classiccycle situpandbegbicycle omafiets urbancycling urbanmobility madeingermany customdesign bespokebicycle handbuilt sustainablefashion sustainablelifestyle sustainableliving sustainabilitymatters sustainablecycling greenmobility copenhagen copenhagenlife wonderfulcopenhagen lovecopenhagen copenhagenstyle bestcopenhagen copenhagendesign designbike

תעביר את זה הלאה.. ימים טרופים אנחנו עוברים. ימים של סגר, של הפעלות יתר לילדים, ימים שאנחנו למדים משפחתיות מה היא. בתוך כל הרעש הזה, אנחנו, בעלי העסקים הקטנים נלחמים על חיינו וזקוקים לעזרתכם. בשקט בשקט הוקמה לה קבוצה ע"י מלכה אמיתית @mandmdar קבוצה המאגדת אותנו המעצבים הלוקאליים לתוך אתר אחד ובו כולנו מזמינים אתכם להנות מהטבות מיוחדות ממש עבורכם. @local.shopping.il אז אם אתם מחפשים מתנה לחג הפסח, ליום הולדת או סתם להביע אהבה ענקיסטית. אנחנו כאן בשבילכם בקבוצה, באינסטגרם ובאתר המדהים הזה כנסו ותפרגנו לנו, העסקים הקטנים, תעשו משהו קטן, טוב והכרחי בימים אלו למשק הישראלי. לינק לאתר - www.local-shopping.org באהבה מורנהgoldrings momsjewelry Customdesign momsringisraeldesign tlvdesignersartisanjewelry signetjewelry signetring instaisrael ii_community moranajewelry backontop_ii

Baba Jaga. Custom design t-shirt for a client who loves Slavic mythology and folklore. Hand painted acrylic on t-shirt.

● Priekšnams. Uzdevumu radīt šeit mākslas klātbūtni mēs izvirzījām kā prioritāro. Pirmais, kas sagaida ikvienu, kas ienācis dzīvoklī nav skapis, pat ne pakaramais. Bet audekls. Un ja ieskatās, tad var pamanīt, ka audekls tieši arī pilda pakaramo lomu. Skapi šeit vienkārši nebija iespējas novietot – divi kvadrātmetri 4 sienās, katrā no tām ir vai nu durvis, vai aila. ● Прихожая. Задачу создать присутствие творчества в этой квартире мы поставили перед собой как первостепенную.  Первое, что встречает любого входящего это не шкаф, не даже вешалка. А холст. И если присмотреться, то можно заметить, что именно холст и выполняет тут функцию вешалки. Шкаф здесь попросту было не разместить – два с небольшим квадратных метра, 4 стены, в каждой из которых или дверь или проем. ● #дизайнеринтерьерарига #прихожая #дизайнприхожей #интерьерприхожей #дизайнинтерьерарига customdesign guash_interior_design guashinteriors interjeraprojektšana interjeradizainers interjeradizains

Det här ska bli en hög hylla som ska ersätta ett trappräcke. Den kommer gå från golv till tak, 2,46 m hög, 1,17 m bred, 35 cm djup. Hyllplanen kommer bestå av parkettgolv som kunden har kvar sedan renovering👍 . . . .inredninguppsala steelinterior industriellinredning inredning rustik rustikinredning custommade customdesign kustomdesign hantverk hylla rcke trappa parkettgolv tervunnetträ tervunnet reused

" I don't want to be your favorite or your best . I want to be your only & forget the rest ❣️ " Get your Mini Wooden Ring Box with us 😍😍 . . . Feel free to ask , Contact us :: Line :: @luu2991p WA :: 0822 9888 7885 box woodenbox boxkayu kotakcincin ringbox woodenringbox weddingbox couplebox coupleday bigday weddingday sangjit sangjitray sangjitday bridal enggagement weddingdecoration weddingneeds cincinnikah kotakcincinnikah kotakcincinkayu customdesign custombox customringbox artwork creation drartwork drartworkinnovation

For the love of beer 🍻 Shop tees showing off our ColourShift Inks. The metallic shades in the hop shift in changing light.

" I don't want to be your favorite or your best . I want to be your only & forget the rest ❣️ " Get your Mini Wooden Ring Box with us 😍😍 . . . Feel free to ask , Contact us :: Line :: @luu2991p WA :: 0822 9888 7885 box woodenbox boxkayu kotakcincin ringbox woodenringbox weddingbox couplebox coupleday bigday weddingday sangjit sangjitray sangjitday bridal enggagement weddingdecoration weddingneeds cincinnikah kotakcincinnikah kotakcincinkayu customdesign custombox customringbox artwork creation drartwork drartworkinnovation

" I don't want to be your favorite or your best . I want to be your only & forget the rest ❣️ " Get your Mini Wooden Ring Box with us 😍😍 . . . Feel free to ask , Contact us :: Line :: @luu2991p WA :: 0822 9888 7885 box woodenbox boxkayu kotakcincin ringbox woodenringbox weddingbox couplebox coupleday bigday weddingday sangjit sangjitray sangjitday bridal enggagement weddingdecoration weddingneeds cincinnikah kotakcincinnikah kotakcincinkayu customdesign custombox customringbox artwork creation drartwork drartworkinnovation

Gratefull in these times for my friends, family and their support the sound of Rain, inspiration and beautiful joinery in the make for a new little project.

@space It's very tough for small businesses completely shutting down the operation. But must be done! In the coming weeks we will update you; till then stay safe in isolation for the greater good! - Bharti Art Jewellers - Surrey & Vancouver For all inquiries please email directly to: info@bhartijewellers.comstaysafe covid bc surreycustomdesign bhartiartjewellers jewellery indianjewels surreybc surreybusiness localvancouverbusiness indianweddings weddingsinsurrey localweddingjewellery diamond diamondjewellery gemstones handmadejewelry weddingbuzz jewelrydesign jewellerymaker jewelryaddict jewelrytrends yvrfashion jewellers

Case hp free fire 🔥🔥 Tag temannya juga yah untuk ikutan punya case terkece ini❤❤ . . ✔CARA ORDER : Langsung hubungi admin kami !! . Wa 085218916824 . ✔ Bisa custom: bisa bebas milih motif semua yg di IG dan bisa pakai desain sendiri bisa untuk SEMUA tipe hp dan banyak Bahan . ✔ Bahan : untuk bahan bisa pilih ada softcase hardcase dan byk lagi jadi tergantung selera kalian tinggal konfirmasi ke admin . ✔ Quality Printing: Kita memilih tinta dan mesin terbaik dari JEPANG. Setiap finishing kami ada lapisan tinta clear yang DOFF atau GLOSSY jadi kayak ada lapisan transparan lindungi Gambar langsung. Jadi Kualitas print kita tajam dan bikin AWET dari anti goresan, Air, merubah warna . ✔Bergaransi:Iya. Bergaransi 100% di tukar jika kalian tidak puas kami ada garansi jadi kualitas ga usah di ragukan, Garansi Harga termurah & berkualitas premium So Be smart buyer😎 . ✔Pengiriman: Untuk pengiriman Cepat kok 1-3 hari, jika mau langsung jadi bisa pakai paket EXPRESS langsung jadi bisa dikirim langsung .customcase customcaseiphone freefiregame custom customdesign freefirememes freefireindonesia

Case hp free fire 🔥🔥 Tag temannya juga yah untuk ikutan punya case terkece ini❤❤ . . ✔CARA ORDER : Langsung hubungi admin kami !! . Wa 085218916824 . ✔ Bisa custom: bisa bebas milih motif semua yg di IG dan bisa pakai desain sendiri bisa untuk SEMUA tipe hp dan banyak Bahan . ✔ Bahan : untuk bahan bisa pilih ada softcase hardcase dan byk lagi jadi tergantung selera kalian tinggal konfirmasi ke admin . ✔ Quality Printing: Kita memilih tinta dan mesin terbaik dari JEPANG. Setiap finishing kami ada lapisan tinta clear yang DOFF atau GLOSSY jadi kayak ada lapisan transparan lindungi Gambar langsung. Jadi Kualitas print kita tajam dan bikin AWET dari anti goresan, Air, merubah warna . ✔Bergaransi:Iya. Bergaransi 100% di tukar jika kalian tidak puas kami ada garansi jadi kualitas ga usah di ragukan, Garansi Harga termurah & berkualitas premium So Be smart buyer😎 . ✔Pengiriman: Untuk pengiriman Cepat kok 1-3 hari, jika mau langsung jadi bisa pakai paket EXPRESS langsung jadi bisa dikirim langsung .customcase customcaseiphone freefiregame custom customdesign freefirememes freefireindonesia

Many thanks to @cwkhalil for an amazing birthday gift and also to the incredible artist @xevpalletcrafts for creating this absolute masterpiece 😭🙏🏼 Give her some love and check out her page! Also please excuse my poor photo taking abilities, better pics of this available on Xev's page! pokemon venusaur bulbasaur forest customdesign grasstypepokemon pokeball

Case hp free fire 🔥🔥 Tag temannya juga yah untuk ikutan punya case terkece ini❤❤ . . ✔CARA ORDER : Langsung hubungi admin kami !! . Wa 085218916824 . ✔ Bisa custom: bisa bebas milih motif semua yg di IG dan bisa pakai desain sendiri bisa untuk SEMUA tipe hp dan banyak Bahan . ✔ Bahan : untuk bahan bisa pilih ada softcase hardcase dan byk lagi jadi tergantung selera kalian tinggal konfirmasi ke admin . ✔ Quality Printing: Kita memilih tinta dan mesin terbaik dari JEPANG. Setiap finishing kami ada lapisan tinta clear yang DOFF atau GLOSSY jadi kayak ada lapisan transparan lindungi Gambar langsung. Jadi Kualitas print kita tajam dan bikin AWET dari anti goresan, Air, merubah warna . ✔Bergaransi:Iya. Bergaransi 100% di tukar jika kalian tidak puas kami ada garansi jadi kualitas ga usah di ragukan, Garansi Harga termurah & berkualitas premium So Be smart buyer😎 . ✔Pengiriman: Untuk pengiriman Cepat kok 1-3 hari, jika mau langsung jadi bisa pakai paket EXPRESS langsung jadi bisa dikirim langsung .customcase customcaseiphone freefiregame custom customdesign freefirememes freefireindonesia

Custom design for Kylo FT Activo Catalogue 2020 Kami sediakan catalog dengan pelbagai design bagi memudahkan anda untuk custom jersey anda, tak usah pening lagi ! Harga berpatutan dan design yang menarik untuk anda semua 😉 Tekan link di bio kami sekarang 🔥bola sublimation printing jersey jersi customdesign customjersey malaysia graphicdesign jersicustom konvoi sport rider esports esportsjersey corona dota2 mobilelegends futsal dodgeball ride football honda kawasaki convoy bolasepak uniform sports y15 design

Let's say it🙌🙌🙌🙌🙌🙌🙌🙌🙌again & again & again & again & again & again & again & again & again & again🙌🙌🙌🙌❣ Stay H💗me❣❣❣❣ Stay H💗ME!!!! Imagination 🙌🙌🙌🙌🙌 Stepping BACK🙌🙌🙌🙌 Make believe 🙌🙌🙌🙌🙌 Imagination 🙌🙌🙌🙌 Intentional 🙌🙌🙌🙌 ✌✌ soar. . . .inspired becoming inprogress working businessowner modernismo.design goals goodvibesonly interiordesign designerlife realestate 2020 lux customdesign brand tinyhouse kitchendesign moderndesign newprojects health alliswell happy mentalhealthawareness beliveinyourself imagination harmony healingStay home enjoy the weather your family and thank God you're healthy>>> count your blessings 🙌🙌🙌

Men’s Black Chevron Panel Printed Zip Through Tracksuit You can add you customization that you want to add just dm us Custom Logo on the place of chevron Custom colors Custom sizes Custom designschevron design customdesign oem tracksuit topselling 2020 training jogging usa america us uk unitedkingdom london england italy germany spain europe canada australia newzealand sweden switzerland netherlands japan paris miami chile

🌻⁣ Sunflower Art with “Fate whispers to the Warrior” printable digital art. Instant download PNG and JPG files for print, cut, sublimation, iron ons, waterslides, card stock, etc. ⁣ ⁣ Visit my shop The Source Unlimited to purchase these files.⁣ •⁣ •••⁣ ••••••⁣ #⁣sunflower digitalart craftersofinstagram craftingideas sublimationprinting sublimation flowers sunflowers etsy etsyfinds etsygifts etsylove cricut teckwrap spring crafts craftlife craftersofinstagram craftersgonnacraft craftaddict craftingismytherapy handmade handcrafted handmadewithlove handmadegifts custom customdesign svgfiles customtumblers personalizedgifts epoxy

We sure are missing being out and about at this time... Throwback to our Customer Appreciation Party last year! Who else CANNOT WAIT to get out of the house? . . . .WindowFilming WindowCoatings WindowTint WindowTinting CustomInstall CustomSigns CustomLogos PureMichigan GraphicDesign CustomDesign CustomBanners 3M GrandRapids GrandRapidsMichigan GRMI BeerCity UVprotection Michigan Filming AwesomeDesigns Windows 616

AMELIA available for orders soon!

Menerima pemesanan furniture asli Jepara dengan kualitas terbaik & harga yang terjangkau Untuk detail informasi dan pemesanan bisa hubungi contact person kami di : WA : 081326251175 Line ID : jm-furniture Phone : +62 813-26251-175 Web : jatiminimalisfurniture.com Jl. Amarta III RT.3 RW.5, Tahunan - Jepara Follow IG kami di : @jati_minimalis_furniture @jati_minimalis_furniture @jati_minimalis_furnituresidetable mejakonsol console konsul bufet credenza blackwash whitewash whitewashfurniture rusticfurniture mebelminimalis mebeljati mebelantik mebeljepara mebelmurah customdesign trustedseller notiputipu amanah rumahunik rumahmungil kemang jakarta jaksel bintaro serpong bandungtrip

Next Page

love - instagood - photooftheday - fashion - beautiful - happy - cute - tbt - like4like - followme - picoftheday - follow - me - selfie - summer - art - instadaily - friends - repost - nature - girl - fun - style - smile - food - travel - holiday

counter