β€οΈπŸ§‘πŸ’›πŸ’šπŸ’™πŸ’œπŸ–€

#kucing

#love #instagood #photooftheday #fashion #beautiful #happy #cute #tbt #like4like #followme #picoftheday #follow #me #selfie #summer #art #instadaily #friends #repost #nature #girl #fun #style #smile #food #travel #holiday

Gingsul emang bikin manis ya 😹 πŸ“· 🐱 @ ・・・ 🐾 Like dan mention teman kamu 😺 ・・・ Follow @galerikucing Follow @klub.kucing ・・・galerikucing klubkucing kucingoren kucing kucingtidur kucingmanja kucingimut kucingku kucingcantik kucingcomel pecintakucing kucingkampung kucingindonesia kucinglucu kucingpintar duniakucing

πŸ›ŽπŸŽ‰[OPEN PAID PROMOTE SEMINAR DIGITAL UNIVERSITAS KRISNADWIPAYANA 2019]πŸŽ‰πŸ›Ž Hallo cat lovers!!! Mau adopsi kucing ras persia yang lucu dan mengemaskan ???? Silakan cek aja @cheapcatfarm di jamin akan selalu puas Cocok untuk hadiah,pets maupun untuk teman kalian Bisa bandingkan biaya di @cheapcatfarm dengan di petshop,tempat lain atau pasar hewan Dimana lagi dapat kucing persia biaya murah,sehat,terpercaya dan berkualitas klo bukan di @cheapcatfarm . . . .jualkucing jualkucingpersiajualkucingpersiamurah jualkucingjakartajualkucingpersiajakarta kucingkucingjakarta kucingpersiakucingpersiajakarta kucingmurahkucingpersiamurah jualkucingbekasijualkucingpersiabekasi kucingbekasikucingpersiabekasi jualkucingtangerangjualkucingpersiatangerang kucingtangerangkucingpersiatangerang jualkucingbogorjualkucingpersiabogor kucingbogorkucingpersiabogor jualkucingdepokjualkucingpersiadepok kucingdepok kucingpersiadepok

Kemaren sore, gak brp lama setelah pulang dari warung sayur, njonjah nanya:" Abi tau ikan asin dimana ? Saia jawab kgk tau.... πŸ€” Ternjattaah oooh ternjattaah sodarah2 ... Pagi ni, saia nemu bungkus ikan asin teronggok di bawah roda motor ... πŸ˜ΎπŸ™€πŸ‘» Cat catlover catlife Kucing

πŸ›ŽπŸŽ‰[ OPEN PAID PROMOTE SEMINAR DIGITAL UNIVERSITAS KRISNADWIPAYANA 2019]πŸŽ‰πŸ›Ž Hallo cat lovers!!! Mau adopsi kucing ras persia yang lucu dan mengemaskan ???? Silakan cek aja @cheapcatfarm di jamin akan selalu puas Cocok untuk hadiah,pets maupun untuk teman kalian Bisa bandingkan biaya di @cheapcatfarm dengan di petshop,tempat lain atau pasar hewan Dimana lagi dapat kucing persia biaya murah,sehat,terpercaya dan berkualitas klo bukan di @cheapcatfarm . . . .jualkucing jualkucingpersiajualkucingpersiamurah jualkucingjakartajualkucingpersiajakarta kucingkucingjakarta kucingpersiakucingpersiajakarta kucingmurahkucingpersiamurah jualkucingbekasijualkucingpersiabekasi kucingbekasikucingpersiabekasi jualkucingtangerangjualkucingpersiatangerang kucingtangerangkucingpersiatangerang jualkucingbogorjualkucingpersiabogor kucingbogorkucingpersiabogor jualkucingdepokjualkucingpersiadepok kucingdepok kucingpersiadepok

πŸ›ŽπŸŽ‰[ OPEN PAID PROMOTE SEMINAR DIGITAL UNIVERSITAS KRISNADWIPAYANA 2019]πŸŽ‰πŸ›Ž Hallo cat lovers!!! Mau adopsi kucing ras persia yang lucu dan mengemaskan ???? Silakan cek aja @cheapcatfarm di jamin akan selalu puas Cocok untuk hadiah,pets maupun untuk teman kalian Bisa bandingkan biaya di @cheapcatfarm dengan di petshop,tempat lain atau pasar hewan Dimana lagi dapat kucing persia biaya murah,sehat,terpercaya dan berkualitas klo bukan di @cheapcatfarm . . . .jualkucing jualkucingpersiajualkucingpersiamurah jualkucingjakartajualkucingpersiajakarta kucingkucingjakarta kucingpersiakucingpersiajakarta kucingmurahkucingpersiamurah jualkucingbekasijualkucingpersiabekasi kucingbekasikucingpersiabekasi jualkucingtangerangjualkucingpersiatangerang kucingtangerangkucingpersiatangerang jualkucingbogorjualkucingpersiabogor kucingbogorkucingpersiabogor jualkucingdepokjualkucingpersiadepok kucingdepok kucingpersiadepok

- yummy, akhirnya stok makanan ku banyaak lagi 😽😽 . . . .lexiquinnthecat cat cats_of_instagram catstagram catofinstagram catloverclub catlover catofthedays redtabbycat meow kucing kucingoren kucinggemes kucinglucu pecintakucing

. . TAG 5 TEMEN KAMU YA. Support Local Creators. Follow‡‡‡ @binjai.vid.gram @binjai.vid.gram @binjai.vid.gram ___________________________ @tebingtinggivideo @hahavidgram @indovidgram @medanvidgram @cikarangvidgrams @jakartavidgram @dagelan @binjaieksis @boomcat.tv .indovidgram medanvidgram binjaividgramindomusikgram musically tiktok vidgram binjaieksis punyabinjai binjai shortmovie dagelan videolucu music laugh lol baper dagelanindo puisi literasi sajak baper prankindonesia younglex baimwong peliharahewan kucing dog ngakak viral

JANGAN GIGIT GIGIT WOI Tag teman kamu juga⁣⁣⁣ .⁣⁣⁣⁣⁣⁣ bantu follow kami supaya semangat ⁣⁣⁣⁣⁣⁣terus uploadnya ya ⁣⁣⁣⁣😊⁣⁣⁣⁣⁣⁣⁣ ⁣⁣⁣⁣⁣⁣ βž–βž–βž–βž–βž–βž–βž–βž–βž–βž–βž–βž–βž–βž–βž–β£β£β£β£β£β£β£β£β£β£β£kucinganggora kucingpersia pecintakucing kucinglucu kucingku kucingkesayangan kucinglovers kucingindonesia kucingcantik kucingkampung kucingcomel kucingimut kucing kucingmalas kucingmanja kucinglucu kucinglovers kucingku anakkucing kucingimut pecintakucing kucingcomel kucingputih kucingmanja kucingkampung kucingkesayangan vidgramindo

Ngakak AnjayπŸ˜‚ . . TAG 5 TEMEN KAMU YA. Support Local Creators. Follow‡‡‡ @binjai.vid.gram @binjai.vid.gram @binjai.vid.gram ___________________________ @tebingtinggivideo @hahavidgram @indovidgram @medanvidgram @cikarangvidgrams @jakartavidgram @dagelan @binjaieksis @boomcat.tv .indovidgram medanvidgram binjaividgramindomusikgram musically tiktok vidgram binjaieksis punyabinjai binjai shortmovie dagelan videolucu music laugh lol baper dagelanindo puisi literasi sajak baper prankindonesia younglex baimwong peliharahewan kucing dog ngakak viral

Pecicilan Sih 🀣 . . TAG 5 TEMEN KAMU YA. Support Local Creators. Follow‡‡‡ @binjai.vid.gram @binjai.vid.gram @binjai.vid.gram ___________________________ @tebingtinggivideo @hahavidgram @indovidgram @medanvidgram @cikarangvidgrams @jakartavidgram @dagelan @binjaieksis @boomcat.tv .indovidgram medanvidgram binjaividgramindomusikgram musically tiktok vidgram binjaieksis punyabinjai binjai shortmovie dagelan videolucu music laugh lol baper dagelanindo puisi literasi sajak baper prankindonesia younglex baimwong peliharahewan kucing dog ngakak viral

Siapa yang pernah nih? . . TAG 5 TEMEN KAMU YA. Support Local Creators. Follow‡‡‡ @binjai.vid.gram @binjai.vid.gram @binjai.vid.gram ___________________________ @tebingtinggivideo @hahavidgram @indovidgram @medanvidgram @cikarangvidgrams @jakartavidgram @dagelan @binjaieksis @boomcat.tv .indovidgram medanvidgram binjaividgramindomusikgram musically tiktok vidgram binjaieksis punyabinjai binjai shortmovie dagelan videolucu music laugh lol baper dagelanindo puisi literasi sajak baper prankindonesia younglex baimwong peliharahewan kucing dog ngakak viral

Ini topi apa yakπŸ˜‚ Aku ciko kucing ke 2 :)kucingpintar kucingpintar kucingimut kucing

Napasnya cepat banget! Tempo hari si jagoan ini habis tempur. Pulang dengan luka sana sini, n perut kempes. Masih sakit nntrauma kayaknya. . . .catsofinstagram kucing

Guess who’s visiting the vet this morning? πŸ™€πŸ˜ΎπŸΎ β€’ β€’ β€’ β€’ β€’ β€’ β€’ β€’ β€’ β€’ β€’ β€’ β€’chatscatsilovecatscutecats catsagram catsofinstagram cats_of_world catsoftheworld meowmeow catsoftheday pawgstagram catscatscats felinefriends felinesofinstagramsiamesecatcatloverscatloversclubpawscatlifeinstacatcat_featurescatvideosmeowedcatlovepetlovekucingkucinglucu 🐾

ηΆΏθ“ε­γΏγŸγ„πŸ’“ γ‘γ‚γ•γ‚“γ΅γ‚γ΅γ‚βœ¨ #猫#ねこ#ネコcat#ぬこ#ちわもこ部#γ‚‚γ‘γ½γ‚ˆιƒ¨#もちもち#ヒフヒフ#にゃんこ#ニャンコcatsofinstagramgattonekokittygatochatkucing#고양이kedi#みんねこ#γƒšγ‚³γ­γ“ιƒ¨#γƒŠγƒ‡γ‚·γƒ«sippo#ζœγƒ―γƒ³γ‚³ε€•γƒ‹γƒ£γƒ³γ‚³#η™½ηŒ« _

Tanpa rasa saling menghormati apa bedanya manusia dengan binatang? . By: Konfusius . . . . .infokemanusiaansosial kemanusiaan sosial motivasi semangat cinta kasih mengasihi keluarga sahabat teman anak ibu orangtua ayah wanita perempuan pria istri suami hewan satwa binatang anjing kucing

Ada je ni masih cuti lagi. Dah keluar hostel dah semalam terus ikut balik Dungun. Saya kencing dalam kereta, nasib baik mommy lapik cat napkin dah siap-siap sebab tahu saya mesti akan kencing punya kalau jalan jauh. Mommy kata takpe lah sebab saya dah tua. πŸ™„πŸ˜‘ .jeri kucing catsofinstagram kisahsheedankucing

Hay ini aku "coki" ; )kucingimut kucingpintarkucing

Si Loly lg liatin apa yaπŸ€”πŸ€”πŸ€” 😽 πŸ‘‡ ====================== Jangan lupa follow 🐈 & Like πŸ’“ Lihat foto & video lainya disini 🐈 Yang bikin ceria dan seru 😻😽 ========================kucingpersia kucinglucu kucingku kucingindonesia kucing anakkucing anakkucinglucu kucingras duniakucing kucinglucu kucingpersia petnangcat kucinglovers kucinghist kucingras lolyiscat

kucing hutan yang hidup liar.. nenek beri makan hingga bentuk badan lari dari habitat sebenar.. garang yang amat dapat di jinak kan dengan zikir & nyanyian.. ..caracal caracaljasmine caracalcat caracalsofinstagram caracalmalaysia caracaldssi caracals kucing kucingku catlover pencintakucing pencintakucingindonesia pencintakucingmalaysia kucingcute kucinglucu kucinggemas kucingmalaysia

Bismillah.. Pose apakah ini dis??? πŸ˜‚ *Gadis kucingdomestik kucingkampung kucinglucu kucing cats cat catstagram catsofinstagram

Yuk nikmati potongan harga senilai 7rb untuk setiap pembelian Cleo freshpack all variant kemasan 1,2kg serta potongan 15rb untuk pembelian Cleo all variant kemasan 7kg . Sampaikan Kritik & Saran kalian ke nomer 081230298300 (hanya wa dan sms) πŸ˜‰ β€’ β€’ - Cherry Pet Shop - Grooming | Hotel | Pet Food | Pet Shampoo | Pet Accessories Β° Β° 🏑 Jl. Dr Wahidin 26 Cilacap πŸ“ž 082227051010 🏑 Jl. Riyanto 628 Sumampir-PWT πŸ“ž082135675959 🏑 Jl. Rinjani 100 Cilacap πŸ“ž 085218819090 🏑 Jl. Mt Haryono 159 Purwokerto πŸ“ž082190900707 Β°cilacap petshop kucing anjing grooming perawatanhewan dokterhewan cherrypet pethotel

Seneeeenggg banget kalau customer kita puas.... πŸ€—πŸ€—πŸ€— . We do our best for your comfyness πŸ™πŸ™πŸ™. . Because Beauty and Details are our concerns πŸ™πŸ™πŸ™ . We are β€œMYCOMFYCAGE” πŸ™πŸ™πŸ™πŸ™. . We made with our passion and our best effort πŸ™πŸ™πŸ™ . Only for one who wants to find beauty and quality πŸ™πŸ™πŸ’•πŸ’• . Knockeddown, no screws and bolts , very easy installation, but strong πŸ’ͺ πŸ’ͺ. We do the best we could, for the design and details πŸ™πŸ™πŸ™ Please .... Look and Notice β€œthe Differences ” of the Material and Design πŸ™πŸ™ FOR A COMFY CAGE .... just contact us 😊😊😊😊 Comfy spot 😘😘 Small, medium, big size 😊😊 Simple, cute yet strong 😘😘😜 😜 Custom Size and Model πŸ˜ŠπŸ˜ŠπŸ™πŸ™ WhatsApp : 081289694969 @mycomfycage @yfportraiture. .kandanganjing kandanganjingmurah kandang kandangkucing kandangkelinci kandangkucingmurah kandangmurah kandanghewan kandangaluminium kandanganjingdijual kandanganjingkecil kandangpagar kandangpagaranjing kandanganjingjakarta kandanganjingjakartacustom kandanganjinglipat kandanglipat pagarlipat pagaranjinglipat anjingdijual petshop anjing kucing kandangknockdown

Apa yang kau berikan itulah yang akan kamu dapatkan...catlover edukasianak kebaikan indonesia kucing pet adoptdontshop

Sabtu lalu saat masih pagi, mumu meong2 minta makan. Krna mamanya blm k pasar jd aq ajak mumu foto2 dlu,pdhal aq msh blm cuci muka 😁😊. Hehe.. ndr77mumumeongkucing

Rutinitas si molly, setelah mandi "Ngisis"mollykucingpersia kucingpersia binatangpeliharaan kucing

Jadi hari ini mau ada dokter datang buat vaksin kita nih? Cia mau pura pura tidur lemes biar gkjd di suntik. Kaya gini nih pura-pura nya. Udah oke belom acting nya? . ..OMGorenji oorenjistory oorenjiandfriendcat oorenjistory oorenjiandfuryfriends Cia.cats_of_world catlover cat_features cats catholic cats_of_instagram catworld catstagram catslife catering catofinstagram catsagram catsoftheworld catalunya catlovers catlife catsofinstagram catsoftheday catoftheday catloversclub cat_of_instagram cat kucing indonesia

NEW PRODUCT di Cherry Pet Shop dari IAMS . Efektif untuk menggemukan anabul karena bahan utamanya Ayam yang penuh dengan protein. Serta didukung dengan berbagai mineral dan nutrisi yang membantu mengurangi hairball dan melancarkan sistem pencernaan. . Sampaikan Kritik & Saran kalian ke nomer 081230298300 (hanya wa dan sms) πŸ˜‰ β€’ β€’ - Cherry Pet Shop - Grooming | Hotel | Pet Food | Pet Shampoo | Pet Accessories Β° Β° 🏑 Jl. Dr Wahidin 26 Cilacap πŸ“ž 082227051010 🏑 Jl. Riyanto 628 Sumampir-PWT πŸ“ž082135675959 🏑 Jl. Rinjani 100 Cilacap πŸ“ž 085218819090 🏑 Jl. Mt Haryono 159 Purwokerto πŸ“ž082190900707 Β°cilacap petshop kucing anjing grooming perawatanhewan dokterhewan cherrypet

Happy Wednesday! We are open as usual, today. See you later. PETSVILLE ANIMAL CLINIC βœ“ Vet Consultation and Services βœ“ Blood test and analysis βœ“ Treatment and Surgery βœ“ Exotic animal treatment βœ“ Cat Boarding and Ward βœ“ Cat Products βœ“ House-call ☎ 03-8328 5954 Waze : petsville animal clinic Isnin - Sabtu: 10am - 8pm Rehat: 2-4pm Jumaat : 4pm - 8pm Ahad & Cuti Umum: 10am - 2pmpetsville petsvilleanimalclinic vetcyberjaya vetsepang amanputra putraperdana vetclinic royalcanin royalcaninmalaysia kucing kucingmalaysia vetmalaysiaklinikhaiwanmalaysia putrajaya

Autumn πŸπŸ’˜ . . .straycat spayed whiskerwednesday calico #δΈ‰θ‰²ηŒ« #猫 kucing meow kot neko kitty cat instacat

Entah kenapa mata kiri aku atit,padahal pertamanya kecil gt lukanya tp kok gak sembuh sembuh ya 😿kucingkucingdomekucingkampungcatloveindonesiakucingindonesiacatindonesia

Aduuhhh itu mpus bahagia bgd ya.. Tidurnya pullleessssss beud Credit lagu ; Negeri di atas awan (KB)cat catlover catlovers kucinglucu kucing pecintakucing tidur

Heyy pagi' udh manjat' aja niπŸ˜…β˜ΊοΈπŸ˜€πŸ˜… 😽 πŸ‘‡ ====================== Jangan lupa follow 🐈 & Like πŸ’“ Lihat foto & video lainya disini 🐈 Yang bikin ceria dan seru 😻😽 ========================kucingpersia kucinglucu kucingku kucingindonesia kucing anakkucing anakkucinglucu kucingras anakkucing duniakucing petnangcat kucinglucu kucingpersia petnangcat kucinglovers kucinghist kucingras

Bismillah..🀲 Ayoo gaess jgn sampe kehabisan!! Great Deal Promo..model terlaris. Dengan harga sangat terjangkau πŸ‘ Siap kirim 24 jam gaess πŸ™ Original Design gaess..yg laen follower doaang πŸ˜πŸ˜‹ Harga Tidak Bohong gaess Bukan Kaleng..Kaleng ini 😎 Quality..Quality..Quality Bisa Kirim ke seluruh Galaxy Raya 😝 Delivered to Tangerang. Hatur nuhuun mba πŸ™πŸ™ Harap bersabar yaa, ini bukan ujian..tapi mobil nya ga muat πŸ˜›πŸ˜ Anter nya satu2 gantian πŸ™πŸ™ Terima kasih sdh mengutamakan Kwalitas gaess.. Jgn lirik kanan kiri gaess..yg jelas2 aja nih ada PELIONA πŸ™πŸ€ŸβœŒ Thank you for order..πŸ™πŸ™ Please Call/wa -0817837308- Cash/Credit Card !! kandangkucing kandangkucingmurah kandangknockdown kandangalmunium kandangaluminium cage catcage petshopjakarta petshop penitipankucingjakarta penitipanhewan catplayground cathotel catcondo cattoys kucing kucinglucu cattery britishshorthair scotishfold mainecoon bali kandangkucingbandung kandangkucingsurabaya kandangkucingbalikandangkucingbintarocatroom kandanganjing

Rumah kami tidaklah besar, walau kecil ada banyak cinta di dalamnya. 😘😘😘😘 Hasil pemotretan hari inih, dengn model Abu, Bulbul, Tachi dan Chiro.mycatskucingsayakucingsayalucucatskucingcatsofthedaycatsofinstagram kucingpersia catloversclub catlover😻

Selamat pagiii, loh loh loh milea, kamu makan nya gakmau rebutan? Apa nunggu kakak2 mu dulu?, si moki jg ni hanya duduk santay, ini habis pada minum vitamin makannya pada kelaperan pagi2. Harus di gencer vitamin terus nih biar pada sarapan semua. Eh tunggu, si milo kemana ini heeeumm😀😀😀😀😀 strayfeeding straycats kucingliar kasih makan kucing liar gembrot gendut ginakginuk makan enak malem ini jangan lupa bawa makanan kucing kemanapun yaaa salammamake mona mocih meli moka moki milea milo

TERCIDUK πŸ˜‚ . . ___________________________________________ πŸ’ŸLike πŸ’¬Comment πŸ‘₯Tag πŸ”„Repost . Jangan lupa Turn On Notifications Instagram kami agar selalu update tentang seputar kucing persia . Lucu : Follow @penscasecustom Gemas : Follow @penscasecustom Suka : Follow @penscasecustom . . πŸ”„ Repost @lovelycatonline . .kucingΒ kucinglucuΒ kucingkesayanganΒ hewankucingpintarΒ duniakucingΒ kucingnakalΒ kucingjahatvideokucinglucuΒ videokucingΒ kucinggemeskucingjantanΒ satwalucuΒ pecintahewanduniabinatangΒ pecintabinatangΒ kucingcomelkucingviralΒ kucingkitaΒ kucingkerenkucinglucubangetΒ kucingorenΒ kucinglucukukucingunyuΒ kucingkocakΒ kucingpinterkucinggemesinΒ kucingmeongΒ pecintakucingindonesiapecintakucing

Follow : @sarangmadu_t.balai πŸ‘ˆπŸ‘ˆπŸ‘ˆπŸ’žπŸ’žπŸ’žπŸ˜ŠπŸ˜ŠπŸ˜Š . . . . Video credit from : @ι˜Ώι‡Œε€šε€šι…± | DY πŸ‘ˆπŸ‘ˆπŸ‘ˆπŸ’žπŸ’žπŸ’žπŸ±πŸ±πŸ± . . . kucinglucu cats kucing anggoracat kucinganggora kucingpersia kucingkampung kucingjakarta kittencat catsofinstagram kucingindonesia videokucinglucu kucingcomel catpersian kucingimut kucingindogram kucingcantik kucingputih catlovers jualbelikucing medanfoodblog kulinerkoko medanzone medantalk medandubbing medaninfo medanese grosirmedan hitsmedan anakmedan

Awalnya, kucing hitam-putih ini bernama Oscar. Berlayar pertama kali dengan kapal perang Bismarck milik Jerman Nazi yang tenggelam pada 27 Mei 1941 dalam pertempuran laut yang sengit. Sam akhirnya ditemukan mengapung pada sebuah papan oleh kapal perang HMS Cossack milik Inggris dan menyelamatkannya. Beberapa bulan setelahnya tepatnya pada 24 Oktober 1941, Kapal HMS Cossack mendapat serangan torpedo dari kapal selam Jerman dan tenggelam pada 27 Oktober 1941. Sam kembali selamat dalam peristiwa tersebut. Kemudian, Oscar di ungsikan ke kapal HMS Ark Royal. Di kapal inilah dipercaya dia mendapat julukan Unsinkable Sam atau Sam yang tidak dapat ditenggelamkan karena pada 14 November 1941 saat berlayar dari Malta, Ark Royal terkena torpedo yang ditembakkan kapal selam Jerman U-81. Kapal ini terbalik dan tenggelam 30 mil dari Gibraltar. Para korban selamat, termasuk Sam, ditemukan mengapung di atas papan yang kemudian diungsikan ke HMS Lightning dan HMS Legion. Source: @mitosduniafaktaonlen faktahariini faktadunia faktaunik faktamenarik infohariini infodunia infofakta infounik infomenarik faktakucing infokucing kucing kocheng kochengoren

Nossa famΓ­lia 🐾😻🌻🌿❀️ @lucasnmendonca @briteseduarda β€’ β€’ β€’ 🐱 kucingmalas kucingmanja toptags manja kucingcomel kucinglucu meong catgram catsgram gatos gatti kediler Katzen katten #ΓάτΡς KatΔ—s animals petstagram cats_of_instagram cats_of_world catgram kittycat nekoclub picneko bestmeow kucing catlove cutecats nekostagram catlife

Kadang ketemu anabul yang malu-malu kucing kayak gini, laper tp maju mundur maju mundur cantikkk cantikkk cantikkkkk . . Mari kita namain anabul ini syahrini, hay syahriniπŸ€—πŸ€—πŸ€—πŸ™ƒπŸ₯°πŸ₯° strayfeeding straycats kucingliar kasih makan kucing liar gembrot gendut ginakginuk makan enak malem ini jangan lupa bawa makanan kucing kemanapun yaaa salammamake syahrini malu malu kucing

Punya kucing mah mana bisa makan dengan tenang πŸ˜ΉπŸ˜…πŸ€£ . . πŸ“· Kiriman @ichimeongpalingcantik ❀ Like dan tag teman kamu yang suka kucing 🐾 Surga belanja bagi pecinta kucing @anabulcom 🐱 Tag foto / video kucingmu ke @kucingmalascom dan gunakan hashtag kucingmalascom

Santuy..............!!!! Mulyo tenan, bubar mangan langsung mapan turu meneh.kucing catlover kucinglokal

Empus pagi-pagi rebutan makanan...πŸ˜‚πŸ˜‚ kucinglucu kucing kucingkesayangan

N Y E N Y A K ~ Dak Sarabanon tido.. dah macam musang dah KODs tengokmeow catsofinstagram cats cat likeforlikes likeforfollow kucing fatcat catstagram catlovers liker followers

Next Page

love - instagood - photooftheday - fashion - beautiful - happy - cute - tbt - like4like - followme - picoftheday - follow - me - selfie - summer - art - instadaily - friends - repost - nature - girl - fun - style - smile - food - travel - holiday

counter